PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR06G18380.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 307aa    MW: 32983.1 Da    PI: 8.3163
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR06G18380.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.53.5e-191459147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg+W++eEde l ++v ++G ++W++I r+++ gR++k+c++rw + 
  LPERR06G18380.1 14 RGPWSPEEDEALRRLVDRHGARNWTAIGREIP-GRSGKSCRLRWCNQ 59
                     89******************************.***********985 PP

2Myb_DNA-binding51.81.8e-1666108145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      r ++T+eEd  +++a+++lG++ W++Iar +  gRt++ +k++w+
  LPERR06G18380.1  66 RRPFTPEEDATILRAHARLGNR-WAAIARLLH-GRTDNAVKNHWN 108
                      679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.062964IPR017930Myb domain
SuperFamilySSF466895.24E-3111107IPR009057Homeodomain-like
SMARTSM007171.5E-161362IPR001005SANT/Myb domain
PfamPF002492.8E-181459IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-251567IPR009057Homeodomain-like
CDDcd001677.66E-161658No hitNo description
SMARTSM007171.2E-1465113IPR001005SANT/Myb domain
PfamPF002492.0E-1466108IPR001005SANT/Myb domain
PROSITE profilePS5129419.05766115IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.6E-2368115IPR009057Homeodomain-like
CDDcd001673.08E-1168108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MGGGGAEAEC DRIRGPWSPE EDEALRRLVD RHGARNWTAI GREIPGRSGK SCRLRWCNQL  60
SPQVERRPFT PEEDATILRA HARLGNRWAA IARLLHGRTD NAVKNHWNCS LKRKLAVATA  120
ASASPTPDVA VVERPCKRMS PSPDSPSSGS GSGSSDRSDL SHGGASGSGG FGQIFRPVAR  180
AGAFEPVVDC AISRRQEEDP LTSLSLSLPG TTMDQRFNHD SAHSHFQELP SSPSPPPPAP  240
PVAIAPTTAA QYPFTPEFAA AMQEMIRAEV HKYMASVGVR AGCGDADVHM PQLMAGVMRA  300
AAERMMH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-38111154108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1058171e-134AK105817.1 Oryza sativa Japonica Group cDNA clone:001-203-C12, full insert sequence.
GenBankAK1215641e-134AK121564.1 Oryza sativa Japonica Group cDNA clone:J033034J16, full insert sequence.
GenBankAP0035731e-134AP003573.3 Oryza sativa Japonica Group genomic DNA, chromosome 6, PAC clone:P0523F01.
GenBankAP0149621e-134AP014962.1 Oryza sativa Japonica Group DNA, chromosome 6, cultivar: Nipponbare, complete sequence.
GenBankCU4062981e-134CU406298.1 Oryza rufipogon (W1943) cDNA clone: ORW1943C110G10, full insert sequence.
GenBankCU4067771e-134CU406777.1 Oryza rufipogon (W1943) cDNA clone: ORW1943C108L17, full insert sequence.
GenBankCU4069041e-134CU406904.1 Oryza rufipogon (W1943) cDNA clone: ORW1943C110F05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641187.11e-153PREDICTED: transcription factor MYB44
SwissprotQ9FDW14e-64MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A0D9WSF00.0A0A0D9WSF0_9ORYZ; Uncharacterized protein
STRINGORGLA06G0184100.11e-153(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78938154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G67300.11e-57myb domain protein r1